What is the catalog number for PRSS1 Peptide - middle region?

The catalog number for PRSS1 Peptide - middle region is orb2001566.

What sizes are available for PRSS1 Peptide - middle region?

PRSS1 Peptide - middle region is available in the following size(s): 100 µg.

Is PRSS1 Peptide - middle region in stock?

PRSS1 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

PRSS1 Peptide - middle region

Product Specifications

Product Name Alternative

TRP1, TRY1, TRY4, TRYP1

UniProt

P07477

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_002760.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

A301-700A-T 10 µg

Rabbit anti-USPl Antibody, Affinity Purified

Sign In for Pricing

View Details

abx036149-01 100 µg

Zinc Finger Matrin-Type Protein 3 (ZMAT3) Antibody

Sign In for Pricing

View Details

abx036149-02 1 mg

Zinc Finger Matrin-Type Protein 3 (ZMAT3) Antibody

Sign In for Pricing

View Details

K0586401 3x 1.0 µg

DFNA5 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing

View Details

PH323693 10 µg

HEPACAM (NM_152722) Human Mass Spec Standard

Sign In for Pricing

View Details

SL0183Po-01 48 Tests

Porcine Parathyroid hormone (PTH) ELISA Kit

Sign In for Pricing

View Details