What is the catalog number for PSG3 Peptide - middle region?

The catalog number for PSG3 Peptide - middle region is orb2001564.

What sizes are available for PSG3 Peptide - middle region?

PSG3 Peptide - middle region is available in the following size(s): 100 µg.

Is PSG3 Peptide - middle region in stock?

PSG3 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

PSG3 Peptide - middle region

Product Specifications

UniProt

Q16557

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_066296.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HIVKRGDGTRGETGHFTFTLYLETPKPSISSSNLYPREDMEAVSLTCDPE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMM18941V 100 µL

N-Myc (MYCN) Mouse Monoclonal Antibody [Clone ID: LBI1D9]

Sign In for Pricing

View Details

orb3154051-01 50 µg

Recombinant Human C1QTNF5 Protein, C-His

Sign In for Pricing

View Details

orb3154051-02 100 µg

Recombinant Human C1QTNF5 Protein, C-His

Sign In for Pricing

View Details

orb3154051-03 1 mg

Recombinant Human C1QTNF5 Protein, C-His

Sign In for Pricing

View Details

19398111 3x 1.0 µg

ERBB2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing

View Details

M27915-01 1 g

PNU-96391

Sign In for Pricing

View Details