What is the catalog number for PSG3 Peptide - middle region?

The catalog number for PSG3 Peptide - middle region is orb2001564.

What sizes are available for PSG3 Peptide - middle region?

PSG3 Peptide - middle region is available in the following size(s): 100 µg.

Is PSG3 Peptide - middle region in stock?

PSG3 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

PSG3 Peptide - middle region

Product Specifications

UniProt

Q16557

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_066296.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HIVKRGDGTRGETGHFTFTLYLETPKPSISSSNLYPREDMEAVSLTCDPE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

K4834801 3x 1.0 µg

Tpm4 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing

View Details

sc-353640A 5 g

Isopropyl (4-chloro-6-phenylthieno[2,3-d]pyrimidin-2-yl) acetate

Sign In for Pricing

View Details

A15249-2 2 mg

ST-836 hydrochloride 2mg

Sign In for Pricing

View Details

RF10002-02 1 pack

HEK293 Cell Slide

Sign In for Pricing

View Details

K4690302 1.0 µg DNA

Tm9sf2 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing

View Details

PVT17285 2 µg

pBlueScriptR-KLHL1 Plasmid

Sign In for Pricing

View Details