Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMA7 Peptide - C-terminal region

PSMA7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C6, HSPC, RC6-1, XAPC7

UniProt

O14818

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_002783.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VQSGGKNIELAVMRRDQSLKILNPEEIEKYVAEIEKEKEENEKKKQKKAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDKN1C Antibody
AM2072B 400 µL

CDKN1C Antibody

Sign In for Pricing
View Details
GluAP (Glutamyl Aminopeptidase, CD249, ENPEP, gp160, ATA, EAP, AP-A, Aminopeptidase A)
363316 200 µL

GluAP (Glutamyl Aminopeptidase, CD249, ENPEP, gp160, ATA, EAP, AP-A, Aminopeptidase A)

Sign In for Pricing
View Details
Porcine Interleukin 1 Beta (IL1b) ELISA Kit
DLR-IL1b-p-48T 48 Tests

Porcine Interleukin 1 Beta (IL1b) ELISA Kit

Sign In for Pricing
View Details
TMEM196 shRNA Plasmid (h)
sc-89771-SH 20 µg

TMEM196 shRNA Plasmid (h)

Sign In for Pricing
View Details
YB039 rabbit pAb
E28PT7302 100 µL

YB039 rabbit pAb

Sign In for Pricing
View Details
Trans-4-[[ (1,1-Dimethylethyl) dimethylsilyl]oxy]cyclohexanol
OR1076632 1 Each

Trans-4-[[ (1,1-Dimethylethyl) dimethylsilyl]oxy]cyclohexanol

Sign In for Pricing
View Details