Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTAFR Peptide - N-terminal region

PTAFR Peptide - N-terminal region

Product Specifications

Product Name Alternative

PAFR

UniProt

P25105

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_000943.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EPHDSSHMDSEFRYTLFPIVYSIIFVLGVIANGYVLWVFARLYPCKKFNE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Haemophilus Influenzae pepB Protein (aa 1-434)
VAng-Lsx03592-1mgEcoli 1 mg (E. coli)

Recombinant Haemophilus Influenzae pepB Protein (aa 1-434)

Sign In for Pricing
View Details
Stxbp2 Mouse siRNA Oligo Duplex (Locus ID 20911)
SR417914 1 Kit

Stxbp2 Mouse siRNA Oligo Duplex (Locus ID 20911)

Sign In for Pricing
View Details
ZNF449 Rabbit Polyclonal Antibody
TA331621 100 µL

ZNF449 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse NQO1/ DT-diaphorase Protein, His, Yeast-200ug
QP9801-ye-200ug 200ug

Recombinant Mouse NQO1/ DT-diaphorase Protein, His, Yeast-200ug

Sign In for Pricing
View Details
ZNF615 (NM_198480) Human Tagged ORF Clone
RG211263 10 µg

ZNF615 (NM_198480) Human Tagged ORF Clone

Sign In for Pricing
View Details
N- (2- (2- (2-Aminoethoxy) ethoxy) ethyl) -4- (3- (trifluoromethyl) -3H-diazirin-3-yl) benzamide
PC1007945-01 1 mg

N- (2- (2- (2-Aminoethoxy) ethoxy) ethyl) -4- (3- (trifluoromethyl) -3H-diazirin-3-yl) benzamide

Sign In for Pricing
View Details