Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTAFR Peptide - N-terminal region

PTAFR Peptide - N-terminal region

Product Specifications

Product Name Alternative

PAFR

UniProt

P25105

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_000943.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EPHDSSHMDSEFRYTLFPIVYSIIFVLGVIANGYVLWVFARLYPCKKFNE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-RASA1 (Tyr460) Rabbit pAb, Pacific Blue conjugated
orb2877666 100 µL

Phospho-RASA1 (Tyr460) Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
DiagNano™ CdSeTe/ZnS Quantum Dots, 800 nm
DNP-X117 10 mg

DiagNano™ CdSeTe/ZnS Quantum Dots, 800 nm

Sign In for Pricing
View Details
Actin, alpha (MaxLight 750)
MBS6256433-01 0.1 mL

Actin, alpha (MaxLight 750)

Sign In for Pricing
View Details
Actin, alpha (MaxLight 750)
MBS6256433-02 5x 0.1 mL

Actin, alpha (MaxLight 750)

Sign In for Pricing
View Details
METAP1 siRNA (Human)
CRH8056-01 15 nmol

METAP1 siRNA (Human)

Sign In for Pricing
View Details
METAP1 siRNA (Human)
CRH8056-02 30 nmol

METAP1 siRNA (Human)

Sign In for Pricing
View Details