Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PYGM Peptide - C-terminal region

PYGM Peptide - C-terminal region

Product Specifications

UniProt

P11217

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001158188.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ANVEMAEEAGEENFFIFGMRVEDVDKLDQRGYNAQEYYDRIPELRQVIEQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRISP-1/3 (m) -PR
sc-44744-PR 10 µM - 20 µL

CRISP-1/3 (m) -PR

Sign In for Pricing
View Details
Mouse Monoclonal IL-3R alpha/CD123 Antibody (32703) [DyLight 755]
FAB301Z 0.1 mL

Mouse Monoclonal IL-3R alpha/CD123 Antibody (32703) [DyLight 755]

Sign In for Pricing
View Details
Lentiviral mouse Dcun1d2 shRNA (UAS) - Lentiviral mouse Dcun1d2 shRNA (UAS) (25)
GTR15211661 1 Vial

Lentiviral mouse Dcun1d2 shRNA (UAS) - Lentiviral mouse Dcun1d2 shRNA (UAS) (25)

Sign In for Pricing
View Details
Cadherin-8 rabbit pAb Antibody
orb767294-01 50 μL

Cadherin-8 rabbit pAb Antibody

Sign In for Pricing
View Details
Cadherin-8 rabbit pAb Antibody
orb767294-02 100 µL

Cadherin-8 rabbit pAb Antibody

Sign In for Pricing
View Details
Octyl Glucose Neopentyl Glycol
MPD0071K Each

Octyl Glucose Neopentyl Glycol

Sign In for Pricing
View Details