What is the catalog number for RAC1 Peptide - middle region?

The catalog number for RAC1 Peptide - middle region is orb2001553.

What sizes are available for RAC1 Peptide - middle region?

RAC1 Peptide - middle region is available in the following size(s): 100 µg.

Is RAC1 Peptide - middle region in stock?

RAC1 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

RAC1 Peptide - middle region

Product Specifications

Product Name Alternative

MIG5, Rac-1, TC-25, p21-Rac1

UniProt

P63000

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_008839.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E109689 1 Each

Rat TNFSF13 ELISA Kit

Sign In for Pricing

View Details

sc-393201 AF594 200 µg/mL

NIPSNAP1/2 (F-4) Alexa Fluor® 594

Sign In for Pricing

View Details

PV169585 500 ng

Cyp2c70 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing

View Details

orb3006494-01 20 µg

Recombinant Human von Willebrand factor (VWF), partial, Biotinylated

Sign In for Pricing

View Details

orb3006494-02 100 µg

Recombinant Human von Willebrand factor (VWF), partial, Biotinylated

Sign In for Pricing

View Details

orb3006494-03 1 mg

Recombinant Human von Willebrand factor (VWF), partial, Biotinylated

Sign In for Pricing

View Details