What is the catalog number for RAC1 Peptide - middle region?

The catalog number for RAC1 Peptide - middle region is orb2001553.

What sizes are available for RAC1 Peptide - middle region?

RAC1 Peptide - middle region is available in the following size(s): 100 µg.

Is RAC1 Peptide - middle region in stock?

RAC1 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

RAC1 Peptide - middle region

Product Specifications

Product Name Alternative

MIG5, Rac-1, TC-25, p21-Rac1

UniProt

P63000

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_008839.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EC2101-7 96 Well Plate

Human Complement C3 AssayMax ELISA Kit (Positive Control included)

Sign In for Pricing

View Details

E44H00971 100 µL

PAKγ (phospho Ser141) Polyclonal Antibody

Sign In for Pricing

View Details

44976121 3x 1.0µg DNA

SNRPD3 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing

View Details

NBP2-04120DL594 0.1 mL

Rabbit Polyclonal TRPS1 Antibody [DyLight 594]

Sign In for Pricing

View Details

G8960-02M-AP 200 µL

GRB2, ID (Growth factor receptor-bound protein 2, Adapter protein GRB2, SH2/SH3 adapter GRB2, Protein Ash, ASH) (AP) discontinued

Sign In for Pricing

View Details

TRV-0049575-01 20 µL

Polyclonal Antibody to Parvalbumin (PVALB)

Sign In for Pricing

View Details