Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBBP4 Peptide - C-terminal region

RBBP4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NURF55, RBAP48, lin-53

UniProt

Q09028

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001128727.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(±)-Perillaldehyde
TRC-P229700-500MG 500 mg

(±)-Perillaldehyde

Sign In for Pricing
View Details
Frozen Tissue Blocks, Gallbladder
CB602299 1 Block

Frozen Tissue Blocks, Gallbladder

Sign In for Pricing
View Details
Gamma Sarcoglycan Antibody
KC-2563-01 50 μL

Gamma Sarcoglycan Antibody

Sign In for Pricing
View Details
Gamma Sarcoglycan Antibody
KC-2563-02 100 µL

Gamma Sarcoglycan Antibody

Sign In for Pricing
View Details
Gamma Sarcoglycan Antibody
KC-2563-03 1 mL

Gamma Sarcoglycan Antibody

Sign In for Pricing
View Details
EIF3B (NM_001037283) Human Over-expression Lysate
LC421939 20 µg

EIF3B (NM_001037283) Human Over-expression Lysate

Sign In for Pricing
View Details