Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RFPL1 Peptide - C-terminal region

RFPL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RNF78

UniProt

O75677

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_066306.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YTFRSVSAEEPLHLFFAPPSPPNGDKSVLSICPVINPGTTDAPVHPGEAK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXP4 Rabbit Polyclonal Antibody
TA371690 100 µL

FOXP4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Blocks, Breast
CB539705 1 Block

Frozen Tissue Blocks, Breast

Sign In for Pricing
View Details
Cytochrome p450 2C19 (CYP2C19) Rabbit Polyclonal Antibody
AP17267PU-N 400 µL

Cytochrome p450 2C19 (CYP2C19) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rat VWF Antibody Pair Set
E-KAB-0395 50 µL & 100 µg

Rat VWF Antibody Pair Set

Sign In for Pricing
View Details
DDIT3 Rabbit Polyclonal Antibody
TA375372 100 µL

DDIT3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
n-Hexadecylpyridinium-d5 Bromide
TRC-N211251-5MG 5 mg

n-Hexadecylpyridinium-d5 Bromide

Sign In for Pricing
View Details