Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RFPL1 Peptide - C-terminal region

RFPL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RNF78

UniProt

O75677

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_066306.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YTFRSVSAEEPLHLFFAPPSPPNGDKSVLSICPVINPGTTDAPVHPGEAK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC344172 Human qPCR Primer Pair (XM_292962)
HP221511 200 Reactions

LOC344172 Human qPCR Primer Pair (XM_292962)

Sign In for Pricing
View Details
Histone H1 (Nuclear Marker) (r1415-1), CF680 conjugate, 0.1mg/mL
BNC801797-500 1x 500 µL

Histone H1 (Nuclear Marker) (r1415-1), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BAX Antibody
KC-628-01 50 μL

BAX Antibody

Sign In for Pricing
View Details
BAX Antibody
KC-628-02 100 µL

BAX Antibody

Sign In for Pricing
View Details
BAX Antibody
KC-628-03 1 mL

BAX Antibody

Sign In for Pricing
View Details
Human INHB Antibody Pair Set
E-KAB-0048 50 µL & 100 µg

Human INHB Antibody Pair Set

Sign In for Pricing
View Details