Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS8 Peptide - N-terminal region

RPS8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

S8

UniProt

P62241

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001003.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GISRDNWHKRRKTGGKRKPYHKKRKYELGRPAANTKIGPRRIHTVRVRGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cell Cycle Phase Determination Antibody Kit
K2004 1 Kit

Cell Cycle Phase Determination Antibody Kit

Sign In for Pricing
View Details
Dolutegravir O-b-D-Glucuronide Sodium salt
TRC-D325260-2.5MG 2.5 mg

Dolutegravir O-b-D-Glucuronide Sodium salt

Sign In for Pricing
View Details
SOX9 / SRY-box 9 (SOX9/2287R), CF568 conjugate, 0.1mg/mL
BNC682287-100 1x 100 µL

SOX9 / SRY-box 9 (SOX9/2287R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Benzthiazide
TRC-B209925-50MG 50 mg

Benzthiazide

Sign In for Pricing
View Details
D-Glutamic Acid-d5
TRC-G596968-10MG 10 mg

D-Glutamic Acid-d5

Sign In for Pricing
View Details
all-trans-Retinoic Acid-d5 (major)
TRC-R250202-2.5MG 2.5 mg

all-trans-Retinoic Acid-d5 (major)

Sign In for Pricing
View Details