Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS8 Peptide - N-terminal region

RPS8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

S8

UniProt

P62241

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001003.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GISRDNWHKRRKTGGKRKPYHKKRKYELGRPAANTKIGPRRIHTVRVRGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KAT5 (NM_006388) Human Recombinant Protein
TP309059L 1 mg

KAT5 (NM_006388) Human Recombinant Protein

Sign In for Pricing
View Details
Tween 20
#22002 1x 50 mL

Tween 20

Sign In for Pricing
View Details
Mouse Fibroblast Growth Factor 18 (FGF18) ELISA Kit
RD-FGF18-Mu-01 96 Tests

Mouse Fibroblast Growth Factor 18 (FGF18) ELISA Kit

Sign In for Pricing
View Details
Mouse Fibroblast Growth Factor 18 (FGF18) ELISA Kit
RD-FGF18-Mu-02 48 Tests

Mouse Fibroblast Growth Factor 18 (FGF18) ELISA Kit

Sign In for Pricing
View Details
Sf3b3 Mouse Gene Knockout Kit (CRISPR)
KN515644 1 Kit

Sf3b3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ethyl Succinoyl Chloride
TRC-E818230-25G 25 g

Ethyl Succinoyl Chloride

Sign In for Pricing
View Details