Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHC1 Peptide - middle region

SHC1 Peptide - middle region

Product Specifications

Product Name Alternative

SHC, SHCA

UniProt

P29353

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001123512.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EPPDHQYYNDFPGKEPPLGGVVDMRLREGAAPGAARPTAPNAQTPSHLGA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CASS4 Protein Vector (Mouse) (pPB-C-His)
PV161738 500 ng

CASS4 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
TNFAIP8L3, ID (TNFAIP8L3, Tumor necrosis factor alpha-induced protein 8-like protein 3) (FITC)
MBS6356870-01 0.2 mL

TNFAIP8L3, ID (TNFAIP8L3, Tumor necrosis factor alpha-induced protein 8-like protein 3) (FITC)

Sign In for Pricing
View Details
TNFAIP8L3, ID (TNFAIP8L3, Tumor necrosis factor alpha-induced protein 8-like protein 3) (FITC)
MBS6356870-02 5x 0.2 mL

TNFAIP8L3, ID (TNFAIP8L3, Tumor necrosis factor alpha-induced protein 8-like protein 3) (FITC)

Sign In for Pricing
View Details
Mouse Monoclonal TAG-72 Antibody (CC49) [Janelia Fluor 549]
NBP2-33128JF549 0.1 mL

Mouse Monoclonal TAG-72 Antibody (CC49) [Janelia Fluor 549]

Sign In for Pricing
View Details
PGP9.5 (UCHL1) Mouse Monoclonal Antibody [Clone ID: OTI8F1]
CF814146 100 µg

PGP9.5 (UCHL1) Mouse Monoclonal Antibody [Clone ID: OTI8F1]

Sign In for Pricing
View Details
Recombinant human NEURL2 protein
ATGP2297-010 10 µg

Recombinant human NEURL2 protein

Sign In for Pricing
View Details