Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHMT1 Peptide - middle region

SHMT1 Peptide - middle region

Product Specifications

Product Name Alternative

SHMT, CSHMT

UniProt

P34896

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001268715.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TSIFFESMPYKVNPDTGYINYDQLEENARLFHPKLIIAGTSCYSRNLEYA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COX2/Cyclooxygenase 2 Mouse mAb
EM1160-01 50 µL

COX2/Cyclooxygenase 2 Mouse mAb

Sign In for Pricing
View Details
COX2/Cyclooxygenase 2 Mouse mAb
EM1160-02 100 µL

COX2/Cyclooxygenase 2 Mouse mAb

Sign In for Pricing
View Details
Guinea pig Complement Component 3 (C3) ELISA Kit
RDR-C3-Gu-96Tests 96 Tests

Guinea pig Complement Component 3 (C3) ELISA Kit

Sign In for Pricing
View Details
TPA Polyclonal Antibody
RA35454-01 50 µL

TPA Polyclonal Antibody

Sign In for Pricing
View Details
TPA Polyclonal Antibody
RA35454-02 100 µL

TPA Polyclonal Antibody

Sign In for Pricing
View Details
SYN1 Antibody
E30AC890 100 µL

SYN1 Antibody

Sign In for Pricing
View Details