Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIM2 Peptide - middle region

SIM2 Peptide - middle region

Product Specifications

Product Name Alternative

SIM, bHLHe15, HMC13F06, HMC29C01

UniProt

Q14190

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_005060.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SWRTALSTSQETRKLVKPKNTKMKTKLRTNPYPPQQYSSFQMDKLECGQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF266 Antibody, Biotin conjugated
A38846-100UG 100 µg

ZNF266 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Methylamine - 2.0M in THF
FM63194-01 1 Kg

Methylamine - 2.0M in THF

Sign In for Pricing
View Details
Methylamine - 2.0M in THF
FM63194-02 2 Kg

Methylamine - 2.0M in THF

Sign In for Pricing
View Details
Methylamine - 2.0M in THF
FM63194-03 5 Kg

Methylamine - 2.0M in THF

Sign In for Pricing
View Details
Methylamine - 2.0M in THF
FM63194-04 10 Kg

Methylamine - 2.0M in THF

Sign In for Pricing
View Details
Methylamine - 2.0M in THF
FM63194-05 25 Kg

Methylamine - 2.0M in THF

Sign In for Pricing
View Details