SIM2 Peptide - middle region
SIM2 Peptide - middle region
Product Specifications
Product Name Alternative
SIM, bHLHe15, HMC13F06, HMC29C01
UniProt
Q14190
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
NCBI Accession Number
NP_005060.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SWRTALSTSQETRKLVKPKNTKMKTKLRTNPYPPQQYSSFQMDKLECGQL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
OR1058583-01 100 mg
(4R,5S) -2- (6-Cyclopropylpyridin-2-yl) -4,5-diphenyl-4,5-dihydrooxazole
Sign In for Pricing
View Details OR1058583-02 250 mg
(4R,5S) -2- (6-Cyclopropylpyridin-2-yl) -4,5-diphenyl-4,5-dihydrooxazole
Sign In for Pricing
View Details OR1058583-03 1 g
(4R,5S) -2- (6-Cyclopropylpyridin-2-yl) -4,5-diphenyl-4,5-dihydrooxazole
Sign In for Pricing
View Details 
HA750018 100 µL
JNK1+JNK2+JNK3 Recombinant Rabbit monoclonal Antibody
Sign In for Pricing
View Details MBS166718-01 48 Well
Human Angiopoietin-like protein 8, ANGPTL8 ELISA Kit
Sign In for Pricing
View Details MBS166718-02 96 Well
Human Angiopoietin-like protein 8, ANGPTL8 ELISA Kit
Sign In for Pricing
View Details