Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC3A2 Peptide - middle region

SLC3A2 Peptide - middle region

Product Specifications

Product Name Alternative

4F2, CD98, MDU1, 4F2HC, 4T2HC, NACAE, CD98HC

UniProt

P08195

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001012680.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DFDSLLQSAKKKSIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Basic Blue 26
TRC-B118748-250MG 250 mg

Basic Blue 26

Sign In for Pricing
View Details
CD45 / LCA (136-4B5), CF647 conjugate, 0.1mg/mL
BNC470173-100 1x 100 µL

CD45 / LCA (136-4B5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NDRG1 Polyclonal Antibody
E-AB-15993-01 20 µL

NDRG1 Polyclonal Antibody

Sign In for Pricing
View Details
NDRG1 Polyclonal Antibody
E-AB-15993-02 60 µL

NDRG1 Polyclonal Antibody

Sign In for Pricing
View Details
NDRG1 Polyclonal Antibody
E-AB-15993-03 120 µL

NDRG1 Polyclonal Antibody

Sign In for Pricing
View Details
NDRG1 Polyclonal Antibody
E-AB-15993-04 200 µL

NDRG1 Polyclonal Antibody

Sign In for Pricing
View Details