Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC3A2 Peptide - middle region

SLC3A2 Peptide - middle region

Product Specifications

Product Name Alternative

4F2, CD98, MDU1, 4F2HC, 4T2HC, NACAE, CD98HC

UniProt

P08195

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001012680.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DFDSLLQSAKKKSIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eph receptor A2 (EPHA2) Mouse Monoclonal Antibody [Clone ID: 3D7]
AM09008PU-S 50 µL

Eph receptor A2 (EPHA2) Mouse Monoclonal Antibody [Clone ID: 3D7]

Sign In for Pricing
View Details
Oxamflatin Ethyl Ester
TRC-O845095-10MG 10 mg

Oxamflatin Ethyl Ester

Sign In for Pricing
View Details
Frozen Tissue Blocks, Colon: right
CB526413 1 Block

Frozen Tissue Blocks, Colon: right

Sign In for Pricing
View Details
HNF6 (ONECUT1) Rabbit Polyclonal Antibody
TA372739 100 µL

HNF6 (ONECUT1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HCG-beta (Pregnancy & Choriocarcinoma Marker) (HCGb/1985R), Biotin conjugate, 0.1mg/mL
BNCB1985-500 1x 500 µL

HCG-beta (Pregnancy & Choriocarcinoma Marker) (HCGb/1985R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human TRAPPC11 activation kit by CRISPRa
GA111886 1 Kit

Human TRAPPC11 activation kit by CRISPRa

Sign In for Pricing
View Details