SPARC Peptide - middle region
SPARC Peptide - middle region
Product Specifications
Product Name Alternative
ON, BM-40
UniProt
P09486
Field of Research
Musculoskeletal & Connective Tissue Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
NCBI Accession Number
NP_003109.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb3012545-01 48 Tests
Human SMAD Family Member 5 (Smad5) ELISA KIT
Sign In for Pricing
View Details orb3012545-02 96 Tests
Human SMAD Family Member 5 (Smad5) ELISA KIT
Sign In for Pricing
View Details orb3012545-03 5 x 96 T
Human SMAD Family Member 5 (Smad5) ELISA KIT
Sign In for Pricing
View Details 
K3324002 1.0 µg DNA
Armc4 sgRNA CRISPR Lentivector (Mouse) (Target 1)
Sign In for Pricing
View Details