Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPARC Peptide - middle region

SPARC Peptide - middle region

Product Specifications

Product Name Alternative

ON, BM-40

UniProt

P09486

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_003109.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nuclear Factor, Erythroid 2 Like 3 (NFE2L3) Antibody
abx235695 100 µg

Nuclear Factor, Erythroid 2 Like 3 (NFE2L3) Antibody

Sign In for Pricing
View Details
Aars2 Mouse Pre-designed siRNA Set A
HY-RS21465 1 Set

Aars2 Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
2’-Iodo-dADP
M-NU-109 150 μl

2’-Iodo-dADP

Sign In for Pricing
View Details
Nek2 inhibitor 3a
M17081-01 1 g

Nek2 inhibitor 3a

Sign In for Pricing
View Details
Nek2 inhibitor 3a
M17081-02 100 mg

Nek2 inhibitor 3a

Sign In for Pricing
View Details
Nek2 inhibitor 3a
M17081-03 200 mg

Nek2 inhibitor 3a

Sign In for Pricing
View Details