Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THBS3 Peptide - middle region

THBS3 Peptide - middle region

Product Specifications

Product Name Alternative

TSP3

UniProt

P49746

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001239536.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CRLFPNKDQQNSDTDSFGDACDNCPNVPNNDQKDTDGNGEGDACDNDVDG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL6 Polyclonal Antibody
MBS2555570-01 0.06 mL

RPL6 Polyclonal Antibody

Sign In for Pricing
View Details
RPL6 Polyclonal Antibody
MBS2555570-02 0.12 mL

RPL6 Polyclonal Antibody

Sign In for Pricing
View Details
RPL6 Polyclonal Antibody
MBS2555570-03 0.2 mL

RPL6 Polyclonal Antibody

Sign In for Pricing
View Details
RPL6 Polyclonal Antibody
MBS2555570-04 5x 0.2 mL

RPL6 Polyclonal Antibody

Sign In for Pricing
View Details
MAGED1/NRAGE polyclonal antibody
BS6145-01 50 µL

MAGED1/NRAGE polyclonal antibody

Sign In for Pricing
View Details
MAGED1/NRAGE polyclonal antibody
BS6145-02 100 µL

MAGED1/NRAGE polyclonal antibody

Sign In for Pricing
View Details