Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THBS3 Peptide - middle region

THBS3 Peptide - middle region

Product Specifications

Product Name Alternative

TSP3

UniProt

P49746

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001239536.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CRLFPNKDQQNSDTDSFGDACDNCPNVPNNDQKDTDGNGEGDACDNDVDG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LAMP2 Human Knockdown Lysate
LY300363 100 µg

LAMP2 Human Knockdown Lysate

Sign In for Pricing
View Details
7-Bromobenz[a]anthracene
TRC-B680378-10MG 10 mg

7-Bromobenz[a]anthracene

Sign In for Pricing
View Details
Myostatin Propeptide (MSTN) (NM_005259) Human Over-expression Lysate
LY401622 100 µg

Myostatin Propeptide (MSTN) (NM_005259) Human Over-expression Lysate

Sign In for Pricing
View Details
Prostate Specific Antigen (PSA) (KLK3/2871R), CF488A conjugate, 0.1mg/mL
BNC882871-100 1x 100 µL

Prostate Specific Antigen (PSA) (KLK3/2871R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NTRK3 antibody
FNab09003 100 µg

NTRK3 antibody

Sign In for Pricing
View Details
CASP3 Rabbit Monoclonal Antibody [Clone ID: 23GB715]
TA425142 100 µL

CASP3 Rabbit Monoclonal Antibody [Clone ID: 23GB715]

Sign In for Pricing
View Details