Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAGLN2 Peptide - middle region

TAGLN2 Peptide - middle region

Product Specifications

Product Name Alternative

HA1756

UniProt

P37802

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001264152.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LGGLAVARDDGLFSGDPNWFPKKSKENPRNFSDNQLQEGKNVIGLQMGTN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mmu-miR-767 miRNA Inhibitor
orb1870254-01 10 nmol

Mmu-miR-767 miRNA Inhibitor

Sign In for Pricing
View Details
Mmu-miR-767 miRNA Inhibitor
orb1870254-02 20 nmol

Mmu-miR-767 miRNA Inhibitor

Sign In for Pricing
View Details
2'- Deoxyguanosine- 5'- O- monophosphorothioate (5'-dGMPS), sodium salt
D 056-05 5 µmol ~ 1.8 mg

2'- Deoxyguanosine- 5'- O- monophosphorothioate (5'-dGMPS), sodium salt

Sign In for Pricing
View Details
5-Chloro-2-hydroxy-pyrimidine 99+% (HPLC)
234090-01 1 g

5-Chloro-2-hydroxy-pyrimidine 99+% (HPLC)

Sign In for Pricing
View Details
5-Chloro-2-hydroxy-pyrimidine 99+% (HPLC)
234090-02 5 g

5-Chloro-2-hydroxy-pyrimidine 99+% (HPLC)

Sign In for Pricing
View Details
5-Chloro-2-hydroxy-pyrimidine 99+% (HPLC)
234090-03 25 g

5-Chloro-2-hydroxy-pyrimidine 99+% (HPLC)

Sign In for Pricing
View Details