Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCAS1 Peptide - middle region

BCAS1 Peptide - middle region

Product Specifications

Product Name Alternative

AIBC1, NABC1

UniProt

O75363

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_003648.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VTTPEPAKEGTKEKSGPTSLPLGKLFWKKSVKEDSVPTGAEENVVCESPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SNX29 activation kit by CRISPRa
GA114177 1 Kit

Human SNX29 activation kit by CRISPRa

Sign In for Pricing
View Details
C16orf95 (NM_001256917) Human Tagged ORF Clone
RG236012 10 µg

C16orf95 (NM_001256917) Human Tagged ORF Clone

Sign In for Pricing
View Details
TGF beta Receptor I (TGFBR1) (NM_004612) Human Over-expression Lysate
LY401457 100 µg

TGF beta Receptor I (TGFBR1) (NM_004612) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Blocks, Kidney
CB506583 1 Block

Frozen Tissue Blocks, Kidney

Sign In for Pricing
View Details
ITGB1 Antibody
OC-002-01 50 μL

ITGB1 Antibody

Sign In for Pricing
View Details
ITGB1 Antibody
OC-002-02 100 µL

ITGB1 Antibody

Sign In for Pricing
View Details