Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B4GALT2 Peptide - middle region

B4GALT2 Peptide - middle region

Product Specifications

Product Name Alternative

B4Gal-T2, B4Gal-T3, beta4Gal-T2

UniProt

O60909

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001005417.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IGRYRMIKHDRDKHNEPNPQRFTKIQNTKLTMKRDGIGSVRYQVLEVSRQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat placenta growth factor, PLGF ELISA Kit
NB-E30513 96 Well

Rat placenta growth factor, PLGF ELISA Kit

Sign In for Pricing
View Details
Olr610 Protein Lysate (Rat) with C-HA Tag
34541036 100 µg

Olr610 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
KALRN Conjugated Antibody
MBS9452494-01 0.1 mL (AF350)

KALRN Conjugated Antibody

Sign In for Pricing
View Details
KALRN Conjugated Antibody
MBS9452494-02 0.1 mL (AF405)

KALRN Conjugated Antibody

Sign In for Pricing
View Details
KALRN Conjugated Antibody
MBS9452494-03 0.1 mL (AF488)

KALRN Conjugated Antibody

Sign In for Pricing
View Details
KALRN Conjugated Antibody
MBS9452494-04 0.1 mL (AF555)

KALRN Conjugated Antibody

Sign In for Pricing
View Details