B4GALT2 Peptide - middle region
B4GALT2 Peptide - middle region
Product Specifications
Product Name Alternative
B4Gal-T2, B4Gal-T3, beta4Gal-T2
UniProt
O60909
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
NCBI Accession Number
NP_001005417.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IGRYRMIKHDRDKHNEPNPQRFTKIQNTKLTMKRDGIGSVRYQVLEVSRQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K6724903 1.0 µg DNA
Lrpprc sgRNA CRISPR Lentivector (Rat) (Target 2)
Sign In for Pricing
View Details bsm-62821R-PE-Cy7 100 µL
SHB Recombinant Antibody, PE-Cy7 Conjugated
Sign In for Pricing
View Details 
058150-01 10 µg
Eukaryotic Brain Derived Neurotrophic Factor (BDNF)
Sign In for Pricing
View Details 058150-02 50 µg
Eukaryotic Brain Derived Neurotrophic Factor (BDNF)
Sign In for Pricing
View Details