Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Irisin, Human/Mouse/Rat (HEK293, N-His)

Irisin is a hormone derived from the FNDC5 gene that promotes energy expenditure via thermogenesis. Irisin Protein, Human/Mouse/Rat (HEK293, N-His) is the recombinant human, rat, mouse-derived Irisin protein, expressed by HEK293 , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Irisin Protein, Human/Mouse/Rat (HEK293, N-His), Human; Rat; Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/irisin-protein-human-mouse-rat-hek-293-his.html

Purity

98.0

Smiles

DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE

Molecular Formula

252995 (Gene_ID) Q8NAU1-1 (D32-E143) (Accession)

Molecular Weight

Approximately 18-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Hyeonwoo Kim, et al. Irisin Mediates Effects on Bone and Fat via αV Integrin Receptors. Cell.|[2]Karan S Rana, et al. Plasma irisin is elevated in type 2 diabetes and is associated with increased E-selectin levels. Cardiovasc Diabetol.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti Mouse IgG (H + L) (Alk Phos)
43R-1415 1 mg

Rabbit anti Mouse IgG (H + L) (Alk Phos)

Sign In for Pricing
View Details
EFHC1 (NM_018100) Human Recombinant Protein
TP305830M 100 µg

EFHC1 (NM_018100) Human Recombinant Protein

Sign In for Pricing
View Details
Collagen VI (COL6A1) Rabbit Monoclonal Antibody
TA422794 100 µL

Collagen VI (COL6A1) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
STMN1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
45755064 1.0 µg DNA

STMN1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
GFAP Monoclonal Antibody
A10209-50UL 50 μL

GFAP Monoclonal Antibody

Sign In for Pricing
View Details
Mouse Sox11 (NM_009234) AAV Particle
MR206174A1V 250 µL

Mouse Sox11 (NM_009234) AAV Particle

Sign In for Pricing
View Details