Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Irisin, Human/Mouse/Rat (HEK293, N-His)

Irisin is a hormone derived from the FNDC5 gene that promotes energy expenditure via thermogenesis. Irisin Protein, Human/Mouse/Rat (HEK293, N-His) is the recombinant human, rat, mouse-derived Irisin protein, expressed by HEK293 , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Irisin Protein, Human/Mouse/Rat (HEK293, N-His), Human; Rat; Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/irisin-protein-human-mouse-rat-hek-293-his.html

Purity

98.0

Smiles

DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE

Molecular Formula

252995 (Gene_ID) Q8NAU1-1 (D32-E143) (Accession)

Molecular Weight

Approximately 18-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Hyeonwoo Kim, et al. Irisin Mediates Effects on Bone and Fat via αV Integrin Receptors. Cell.|[2]Karan S Rana, et al. Plasma irisin is elevated in type 2 diabetes and is associated with increased E-selectin levels. Cardiovasc Diabetol.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caspase 8 antibody
70R-49472 100 ul

Caspase 8 antibody

Sign In for Pricing
View Details
Pdap1 sgRNA CRISPR Lentivector set (Rat)
K7090301 3x 1.0 µg

Pdap1 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
DOCK9 Rabbit Polyclonal Antibody
JOT-AP09317-01 50ul

DOCK9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DOCK9 Rabbit Polyclonal Antibody
JOT-AP09317-02 100ul

DOCK9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Glutathione S Transferase alpha (GSTa) Guinea Pig ELISA Kit
B1663 96 Tests

Glutathione S Transferase alpha (GSTa) Guinea Pig ELISA Kit

Sign In for Pricing
View Details
Evolitrine
HY-N5022-01 1 mg

Evolitrine

Sign In for Pricing
View Details