Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Irisin, Human/Mouse/Rat (HEK293, N-His)

Irisin is a hormone derived from the FNDC5 gene that promotes energy expenditure via thermogenesis. Irisin Protein, Human/Mouse/Rat (HEK293, N-His) is the recombinant human, rat, mouse-derived Irisin protein, expressed by HEK293 , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Irisin Protein, Human/Mouse/Rat (HEK293, N-His), Human; Rat; Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/irisin-protein-human-mouse-rat-hek-293-his.html

Purity

98.0

Smiles

DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE

Molecular Formula

252995 (Gene_ID) Q8NAU1-1 (D32-E143) (Accession)

Molecular Weight

Approximately 18-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Hyeonwoo Kim, et al. Irisin Mediates Effects on Bone and Fat via αV Integrin Receptors. Cell.|[2]Karan S Rana, et al. Plasma irisin is elevated in type 2 diabetes and is associated with increased E-selectin levels. Cardiovasc Diabetol.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

S100 alpha chain (Bpb, NEF, S100-A1, S100 Alpha Chain, S100 Beta Chain, S100 Calcium Binding Protein A1, S100 Calcium Binding Protein B, S100 Calcium Binding Protein Beta Neural) (BSA & Azide Free) (MaxLight 405)
MBS6194037-01 0.1 mL

S100 alpha chain (Bpb, NEF, S100-A1, S100 Alpha Chain, S100 Beta Chain, S100 Calcium Binding Protein A1, S100 Calcium Binding Protein B, S100 Calcium Binding Protein Beta Neural) (BSA & Azide Free) (MaxLight 405)

Sign In for Pricing
View Details
S100 alpha chain (Bpb, NEF, S100-A1, S100 Alpha Chain, S100 Beta Chain, S100 Calcium Binding Protein A1, S100 Calcium Binding Protein B, S100 Calcium Binding Protein Beta Neural) (BSA & Azide Free) (MaxLight 405)
MBS6194037-02 5x 0.1 mL

S100 alpha chain (Bpb, NEF, S100-A1, S100 Alpha Chain, S100 Beta Chain, S100 Calcium Binding Protein A1, S100 Calcium Binding Protein B, S100 Calcium Binding Protein Beta Neural) (BSA & Azide Free) (MaxLight 405)

Sign In for Pricing
View Details
CABP (CABP1) (NM_004276) Human Tagged Lenti ORF Clone
RC212438L3 10 µg

CABP (CABP1) (NM_004276) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit Monoclonal GCSH Antibody (187) [DyLight 650]
NBP2-90290C 0.1 mL

Rabbit Monoclonal GCSH Antibody (187) [DyLight 650]

Sign In for Pricing
View Details
Human Putative Golgi pH regulator C, GPR89C ELISA Kit
MBS9338189-01 48 Well

Human Putative Golgi pH regulator C, GPR89C ELISA Kit

Sign In for Pricing
View Details
Human Putative Golgi pH regulator C, GPR89C ELISA Kit
MBS9338189-02 96 Well

Human Putative Golgi pH regulator C, GPR89C ELISA Kit

Sign In for Pricing
View Details