Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Irisin, Human/Mouse/Rat (HEK293, N-His)

Irisin is a hormone derived from the FNDC5 gene that promotes energy expenditure via thermogenesis. Irisin Protein, Human/Mouse/Rat (HEK293, N-His) is the recombinant human, rat, mouse-derived Irisin protein, expressed by HEK293 , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Irisin Protein, Human/Mouse/Rat (HEK293, N-His), Human; Rat; Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/irisin-protein-human-mouse-rat-hek-293-his.html

Purity

98.0

Smiles

DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE

Molecular Formula

252995 (Gene_ID) Q8NAU1-1 (D32-E143) (Accession)

Molecular Weight

Approximately 18-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Hyeonwoo Kim, et al. Irisin Mediates Effects on Bone and Fat via αV Integrin Receptors. Cell.|[2]Karan S Rana, et al. Plasma irisin is elevated in type 2 diabetes and is associated with increased E-selectin levels. Cardiovasc Diabetol.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIK3AP1 Recombinant Protein (Mouse)
RP162122 100 µg

PIK3AP1 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Abscisic acid receptor PYL1
MBS9421991-01 0.02 mg

Recombinant Arabidopsis thaliana Abscisic acid receptor PYL1

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Abscisic acid receptor PYL1
MBS9421991-02 0.1 mg

Recombinant Arabidopsis thaliana Abscisic acid receptor PYL1

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Abscisic acid receptor PYL1
MBS9421991-03 1 mg

Recombinant Arabidopsis thaliana Abscisic acid receptor PYL1

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Abscisic acid receptor PYL1
MBS9421991-04 5x 1 mg

Recombinant Arabidopsis thaliana Abscisic acid receptor PYL1

Sign In for Pricing
View Details
MTSS1 CRISPR Activation Plasmid (m2)
sc-431738-ACT-2 20 µg

MTSS1 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details