Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Irisin, Human/Mouse/Rat (HEK293, N-His)

Irisin is a hormone derived from the FNDC5 gene that promotes energy expenditure via thermogenesis. Irisin Protein, Human/Mouse/Rat (HEK293, N-His) is the recombinant human, rat, mouse-derived Irisin protein, expressed by HEK293 , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Irisin Protein, Human/Mouse/Rat (HEK293, N-His), Human; Rat; Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/irisin-protein-human-mouse-rat-hek-293-his.html

Purity

98.0

Smiles

DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE

Molecular Formula

252995 (Gene_ID) Q8NAU1-1 (D32-E143) (Accession)

Molecular Weight

Approximately 18-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Hyeonwoo Kim, et al. Irisin Mediates Effects on Bone and Fat via αV Integrin Receptors. Cell.|[2]Karan S Rana, et al. Plasma irisin is elevated in type 2 diabetes and is associated with increased E-selectin levels. Cardiovasc Diabetol.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Grik3 (EAA5, Excitatory amino acid receptor 5, GLR7, GluR7, GLUR7, GluR-7, GluR7a, Glutamate receptor, ionotropic kainate 3 precursor, Glutamate receptor 7)
G4005-96E 100 µg

Grik3 (EAA5, Excitatory amino acid receptor 5, GLR7, GluR7, GLUR7, GluR-7, GluR7a, Glutamate receptor, ionotropic kainate 3 precursor, Glutamate receptor 7)

Sign In for Pricing
View Details
Immortalized Human Hair Follicle Inner Root Sheath Cells - HPV16 E6/E7
T9234 1x 10^6 Cells - 1.0 mL

Immortalized Human Hair Follicle Inner Root Sheath Cells - HPV16 E6/E7

Sign In for Pricing
View Details
MATR3 Recombinant Antibody
bsm-63230R 100 µL

MATR3 Recombinant Antibody

Sign In for Pricing
View Details
USP51 (Ubiquitin Carboxyl-Terminal Hydrolase 51, Deubiquitinating Enzyme 51, Ubiquitin Thioesterase 51, Ubiquitin-specific-processing Protease 51, USP51) (APC)
MBS6460145-01 0.2 mL

USP51 (Ubiquitin Carboxyl-Terminal Hydrolase 51, Deubiquitinating Enzyme 51, Ubiquitin Thioesterase 51, Ubiquitin-specific-processing Protease 51, USP51) (APC)

Sign In for Pricing
View Details
USP51 (Ubiquitin Carboxyl-Terminal Hydrolase 51, Deubiquitinating Enzyme 51, Ubiquitin Thioesterase 51, Ubiquitin-specific-processing Protease 51, USP51) (APC)
MBS6460145-02 5x 0.2 mL

USP51 (Ubiquitin Carboxyl-Terminal Hydrolase 51, Deubiquitinating Enzyme 51, Ubiquitin Thioesterase 51, Ubiquitin-specific-processing Protease 51, USP51) (APC)

Sign In for Pricing
View Details
Recombinant Human DKK4 Protein, N-His
E55P3158 50 µg

Recombinant Human DKK4 Protein, N-His

Sign In for Pricing
View Details