Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Irisin, Human/Mouse/Rat (HEK293, N-His)

Irisin is a hormone derived from the FNDC5 gene that promotes energy expenditure via thermogenesis. Irisin Protein, Human/Mouse/Rat (HEK293, N-His) is the recombinant human, rat, mouse-derived Irisin protein, expressed by HEK293 , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Irisin Protein, Human/Mouse/Rat (HEK293, N-His), Human; Rat; Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/irisin-protein-human-mouse-rat-hek-293-his.html

Purity

98.0

Smiles

DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE

Molecular Formula

252995 (Gene_ID) Q8NAU1-1 (D32-E143) (Accession)

Molecular Weight

Approximately 18-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Hyeonwoo Kim, et al. Irisin Mediates Effects on Bone and Fat via αV Integrin Receptors. Cell.|[2]Karan S Rana, et al. Plasma irisin is elevated in type 2 diabetes and is associated with increased E-selectin levels. Cardiovasc Diabetol.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc35e3 sgRNA CRISPR Lentivector set (Mouse)
K3700601 3x 1.0 µg

Slc35e3 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Anti-HDAC3 Rabbit pAb
GB115591 100 μL

Anti-HDAC3 Rabbit pAb

Sign In for Pricing
View Details
Human anti-nucleolus antibody,ANA ELISA Kit
CN-03766H1 96T

Human anti-nucleolus antibody,ANA ELISA Kit

Sign In for Pricing
View Details
APOA1, NT (APOA1, Apolipoprotein A-I, Apolipoprotein A1, Truncated apolipoprotein A-I, Apolipoprotein A-I(1-242)) (MaxLight 650)
MBS6220557-01 0.1 mL

APOA1, NT (APOA1, Apolipoprotein A-I, Apolipoprotein A1, Truncated apolipoprotein A-I, Apolipoprotein A-I(1-242)) (MaxLight 650)

Sign In for Pricing
View Details
APOA1, NT (APOA1, Apolipoprotein A-I, Apolipoprotein A1, Truncated apolipoprotein A-I, Apolipoprotein A-I(1-242)) (MaxLight 650)
MBS6220557-02 5x 0.1 mL

APOA1, NT (APOA1, Apolipoprotein A-I, Apolipoprotein A1, Truncated apolipoprotein A-I, Apolipoprotein A-I(1-242)) (MaxLight 650)

Sign In for Pricing
View Details
Homer1 Antibody (YA3035, Rabbit)
HY-P83290-01 10 µL

Homer1 Antibody (YA3035, Rabbit)

Sign In for Pricing
View Details