Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Irisin, Human/Mouse/Rat (HEK293, N-His)

Irisin is a hormone derived from the FNDC5 gene that promotes energy expenditure via thermogenesis. Irisin Protein, Human/Mouse/Rat (HEK293, N-His) is the recombinant human, rat, mouse-derived Irisin protein, expressed by HEK293 , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Irisin Protein, Human/Mouse/Rat (HEK293, N-His), Human; Rat; Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/irisin-protein-human-mouse-rat-hek-293-his.html

Purity

98.0

Smiles

DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE

Molecular Formula

252995 (Gene_ID) Q8NAU1-1 (D32-E143) (Accession)

Molecular Weight

Approximately 18-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Hyeonwoo Kim, et al. Irisin Mediates Effects on Bone and Fat via αV Integrin Receptors. Cell.|[2]Karan S Rana, et al. Plasma irisin is elevated in type 2 diabetes and is associated with increased E-selectin levels. Cardiovasc Diabetol.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Carboxypeptidase B2 (CPB2) ELISA Kit
MBS9924054 Inquire

Goat Carboxypeptidase B2 (CPB2) ELISA Kit

Sign In for Pricing
View Details
ERCC1 Mouse Monoclonal Antibody [Clone ID: LBI1C3]
AMM10255VCF 100 µg

ERCC1 Mouse Monoclonal Antibody [Clone ID: LBI1C3]

Sign In for Pricing
View Details
Rabbit anti-Phospho Histone H3 (510) Antibody, Affinity Purified
A301-844A 20 µg

Rabbit anti-Phospho Histone H3 (510) Antibody, Affinity Purified

Sign In for Pricing
View Details
Mouse Gpm6a (BC023461) AAV Particle
MR203545A1V 250 µL

Mouse Gpm6a (BC023461) AAV Particle

Sign In for Pricing
View Details
Lor (NM_008508) Mouse Untagged Clone
MC203602 10 µg

Lor (NM_008508) Mouse Untagged Clone

Sign In for Pricing
View Details
Recombinant Anti-TXNRD1 Rabbit mAb
CMA4096-01 30 µL

Recombinant Anti-TXNRD1 Rabbit mAb

Sign In for Pricing
View Details