Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Irisin, Human/Mouse/Rat (HEK293, N-His)

Irisin is a hormone derived from the FNDC5 gene that promotes energy expenditure via thermogenesis. Irisin Protein, Human/Mouse/Rat (HEK293, N-His) is the recombinant human, rat, mouse-derived Irisin protein, expressed by HEK293 , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Irisin Protein, Human/Mouse/Rat (HEK293, N-His), Human; Rat; Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/irisin-protein-human-mouse-rat-hek-293-his.html

Purity

98.0

Smiles

DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE

Molecular Formula

252995 (Gene_ID) Q8NAU1-1 (D32-E143) (Accession)

Molecular Weight

Approximately 18-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Hyeonwoo Kim, et al. Irisin Mediates Effects on Bone and Fat via αV Integrin Receptors. Cell.|[2]Karan S Rana, et al. Plasma irisin is elevated in type 2 diabetes and is associated with increased E-selectin levels. Cardiovasc Diabetol.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Tau Protein - (Dry Ice)
NBP2-76793-100ug 100 µg

Recombinant Human Tau Protein - (Dry Ice)

Sign In for Pricing
View Details
Human Ankyrin repeat and SOCS box protein 15 (ASB15) ELISA Kit
abx502687 96 Tests

Human Ankyrin repeat and SOCS box protein 15 (ASB15) ELISA Kit

Sign In for Pricing
View Details
BARX2 sgRNA CRISPR Lentivector (Human) (Target 1)
K0169902 1.0 µg DNA

BARX2 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
CCDC22 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B4]
TA811119AM 100 µL

CCDC22 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B4]

Sign In for Pricing
View Details
SAP155 (SF3B1) (NM_001005526) Human Tagged ORF Clone Lentiviral Particle
RC219649L3V 200 µL

SAP155 (SF3B1) (NM_001005526) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Asymmetric dimethylarginine (Standard)
HY-113216R-01 5 mg

Asymmetric dimethylarginine (Standard)

Sign In for Pricing
View Details