Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Irisin, Human/Mouse/Rat (HEK293, N-His)

Irisin is a hormone derived from the FNDC5 gene that promotes energy expenditure via thermogenesis. Irisin Protein, Human/Mouse/Rat (HEK293, N-His) is the recombinant human, rat, mouse-derived Irisin protein, expressed by HEK293 , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Irisin Protein, Human/Mouse/Rat (HEK293, N-His), Human; Rat; Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/irisin-protein-human-mouse-rat-hek-293-his.html

Purity

98.0

Smiles

DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE

Molecular Formula

252995 (Gene_ID) Q8NAU1-1 (D32-E143) (Accession)

Molecular Weight

Approximately 18-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Hyeonwoo Kim, et al. Irisin Mediates Effects on Bone and Fat via αV Integrin Receptors. Cell.|[2]Karan S Rana, et al. Plasma irisin is elevated in type 2 diabetes and is associated with increased E-selectin levels. Cardiovasc Diabetol.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Plakophilin 1 Antibody (10B2) [Janelia Fluor 549]
NBP2-54526JF549 0.1 mL

Mouse Monoclonal Plakophilin 1 Antibody (10B2) [Janelia Fluor 549]

Sign In for Pricing
View Details
ALPK1 (NM_001253884) Human Tagged ORF Clone
RC235202 10 µg

ALPK1 (NM_001253884) Human Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Trmt61a ELISA KIT
ELI-36578m 96 Tests

Mouse Trmt61a ELISA KIT

Sign In for Pricing
View Details
p21 ARC Goat Polyclonal Antibody
TA302941 100 µg

p21 ARC Goat Polyclonal Antibody

Sign In for Pricing
View Details
Tyrphostin AG 1024
468389-01 1 mg

Tyrphostin AG 1024

Sign In for Pricing
View Details
Tyrphostin AG 1024
468389-02 5 mg

Tyrphostin AG 1024

Sign In for Pricing
View Details