Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Irisin, Human/Mouse/Rat (HEK293, N-His)

Irisin is a hormone derived from the FNDC5 gene that promotes energy expenditure via thermogenesis. Irisin Protein, Human/Mouse/Rat (HEK293, N-His) is the recombinant human, rat, mouse-derived Irisin protein, expressed by HEK293 , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Irisin Protein, Human/Mouse/Rat (HEK293, N-His), Human; Rat; Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/irisin-protein-human-mouse-rat-hek-293-his.html

Purity

98.0

Smiles

DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE

Molecular Formula

252995 (Gene_ID) Q8NAU1-1 (D32-E143) (Accession)

Molecular Weight

Approximately 18-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Hyeonwoo Kim, et al. Irisin Mediates Effects on Bone and Fat via αV Integrin Receptors. Cell.|[2]Karan S Rana, et al. Plasma irisin is elevated in type 2 diabetes and is associated with increased E-selectin levels. Cardiovasc Diabetol.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zar1l sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3062503 1.0 µg DNA

Zar1l sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Human Primary Mononuclear Cells
AFG-ELL-0402 > 5x 10^5 Cells / Vial

Human Primary Mononuclear Cells

Sign In for Pricing
View Details
Mouse Osteonectin (ON) ELISA Kit-Sandwich
EK5F342-01 48 Test

Mouse Osteonectin (ON) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Mouse Osteonectin (ON) ELISA Kit-Sandwich
EK5F342-02 96 Tests

Mouse Osteonectin (ON) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Recombinant Legionella Pneumophila atpH Protein (aa 1-180) (strain Lens)
VAng-Lsx04281-500gEcoli 500 µg (E. coli)

Recombinant Legionella Pneumophila atpH Protein (aa 1-180) (strain Lens)

Sign In for Pricing
View Details
ASXL1 (KIAA0978, Putative Polycomb Group Protein ASXL1, Additional Sex Combs-like Protein 1, MGC117280, MGC71111) (Biotin)
MBS6140710-01 0.1 mL

ASXL1 (KIAA0978, Putative Polycomb Group Protein ASXL1, Additional Sex Combs-like Protein 1, MGC117280, MGC71111) (Biotin)

Sign In for Pricing
View Details