Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Irisin, Human/Mouse/Rat (HEK293, N-His)

Irisin is a hormone derived from the FNDC5 gene that promotes energy expenditure via thermogenesis. Irisin Protein, Human/Mouse/Rat (HEK293, N-His) is the recombinant human, rat, mouse-derived Irisin protein, expressed by HEK293 , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Irisin Protein, Human/Mouse/Rat (HEK293, N-His), Human; Rat; Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/irisin-protein-human-mouse-rat-hek-293-his.html

Purity

98.0

Smiles

DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE

Molecular Formula

252995 (Gene_ID) Q8NAU1-1 (D32-E143) (Accession)

Molecular Weight

Approximately 18-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Hyeonwoo Kim, et al. Irisin Mediates Effects on Bone and Fat via αV Integrin Receptors. Cell.|[2]Karan S Rana, et al. Plasma irisin is elevated in type 2 diabetes and is associated with increased E-selectin levels. Cardiovasc Diabetol.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC285262 Human qPCR Primer Pair (XM_208309)
HP221263 200 Reactions

LOC285262 Human qPCR Primer Pair (XM_208309)

Sign In for Pricing
View Details
Dydc1 ORF Vector (Mouse) (pORF)
ORF043455 1.0 µg DNA

Dydc1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Human Proteasome Subunit Beta Type 5 (PSMb5) ELISA Kit
YP-W13699-01 48 Tests

Human Proteasome Subunit Beta Type 5 (PSMb5) ELISA Kit

Sign In for Pricing
View Details
Human Proteasome Subunit Beta Type 5 (PSMb5) ELISA Kit
YP-W13699-02 96 Tests

Human Proteasome Subunit Beta Type 5 (PSMb5) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human NEK4 Protein
E30P7295 20 µg

Recombinant Human NEK4 Protein

Sign In for Pricing
View Details
Rabbit Monoclonal Napsin A Antibody (NAPSA/4400R) [DyLight 488]
NBP3-08378G 100 µL

Rabbit Monoclonal Napsin A Antibody (NAPSA/4400R) [DyLight 488]

Sign In for Pricing
View Details