Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Irisin, Human/Mouse/Rat (HEK293, N-His)

Irisin is a hormone derived from the FNDC5 gene that promotes energy expenditure via thermogenesis. Irisin Protein, Human/Mouse/Rat (HEK293, N-His) is the recombinant human, rat, mouse-derived Irisin protein, expressed by HEK293 , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Irisin Protein, Human/Mouse/Rat (HEK293, N-His), Human; Rat; Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/irisin-protein-human-mouse-rat-hek-293-his.html

Purity

98.0

Smiles

DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE

Molecular Formula

252995 (Gene_ID) Q8NAU1-1 (D32-E143) (Accession)

Molecular Weight

Approximately 18-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Hyeonwoo Kim, et al. Irisin Mediates Effects on Bone and Fat via αV Integrin Receptors. Cell.|[2]Karan S Rana, et al. Plasma irisin is elevated in type 2 diabetes and is associated with increased E-selectin levels. Cardiovasc Diabetol.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human S100B Monoclonal Antibody
E55A11212 100 µL

Human S100B Monoclonal Antibody

Sign In for Pricing
View Details
AMELY 3'UTR GFP Stable Cell Line
TU050696 1.0 mL

AMELY 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Nat8f5 (NM_080884) Rat Tagged ORF Clone Lentiviral Particle
RR209468L3V 200 µL

Nat8f5 (NM_080884) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CAMK1 Polyclonal Antibody
NHP-AB315 Each

CAMK1 Polyclonal Antibody

Sign In for Pricing
View Details
GTF2H2 (General Transcription Factor IIH Subunit 2, General Transcription Factor IIH Polypeptide 2, TFIIH Basal Transcription Factor Complex p44 Subunit, Basic Transcription Factor 2 44kD Subunit, BTF2-p44, BTF2P44) (MaxLight 750) discontinued
127640-ML750 100 µL

GTF2H2 (General Transcription Factor IIH Subunit 2, General Transcription Factor IIH Polypeptide 2, TFIIH Basal Transcription Factor Complex p44 Subunit, Basic Transcription Factor 2 44kD Subunit, BTF2-p44, BTF2P44) (MaxLight 750) discontinued

Sign In for Pricing
View Details
L-Asarinin
TB0759 20mg

L-Asarinin

Sign In for Pricing
View Details