Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Irisin, Human/Mouse/Rat (HEK293, N-His)

Irisin is a hormone derived from the FNDC5 gene that promotes energy expenditure via thermogenesis. Irisin Protein, Human/Mouse/Rat (HEK293, N-His) is the recombinant human, rat, mouse-derived Irisin protein, expressed by HEK293 , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Irisin Protein, Human/Mouse/Rat (HEK293, N-His), Human; Rat; Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/irisin-protein-human-mouse-rat-hek-293-his.html

Purity

98.0

Smiles

DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE

Molecular Formula

252995 (Gene_ID) Q8NAU1-1 (D32-E143) (Accession)

Molecular Weight

Approximately 18-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Hyeonwoo Kim, et al. Irisin Mediates Effects on Bone and Fat via αV Integrin Receptors. Cell.|[2]Karan S Rana, et al. Plasma irisin is elevated in type 2 diabetes and is associated with increased E-selectin levels. Cardiovasc Diabetol.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human recombinant MMP7 (proenzyme) protein, AF
PROTP09237-4-100ug 100 µg

Human recombinant MMP7 (proenzyme) protein, AF

Sign In for Pricing
View Details
Pcdh11x Blocking Peptide
33R-5239 100 ug

Pcdh11x Blocking Peptide

Sign In for Pricing
View Details
HERC5 (NM_016323) Human Over-expression Lysate
LS051191-20ug 20 µg

HERC5 (NM_016323) Human Over-expression Lysate

Sign In for Pricing
View Details
Protein Phosphatase 1 alpha (PP1a) (MaxLight 490) discontinued
P9107-11-ML490 100 µL

Protein Phosphatase 1 alpha (PP1a) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Rab 2A Antibody
C18237-01 50 μL

Rab 2A Antibody

Sign In for Pricing
View Details
Rab 2A Antibody
C18237-02 100 µL

Rab 2A Antibody

Sign In for Pricing
View Details