Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Irisin, Human/Mouse/Rat (HEK293, N-His)

Irisin is a hormone derived from the FNDC5 gene that promotes energy expenditure via thermogenesis. Irisin Protein, Human/Mouse/Rat (HEK293, N-His) is the recombinant human, rat, mouse-derived Irisin protein, expressed by HEK293 , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Irisin Protein, Human/Mouse/Rat (HEK293, N-His), Human; Rat; Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/irisin-protein-human-mouse-rat-hek-293-his.html

Purity

98.0

Smiles

DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE

Molecular Formula

252995 (Gene_ID) Q8NAU1-1 (D32-E143) (Accession)

Molecular Weight

Approximately 18-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Hyeonwoo Kim, et al. Irisin Mediates Effects on Bone and Fat via αV Integrin Receptors. Cell.|[2]Karan S Rana, et al. Plasma irisin is elevated in type 2 diabetes and is associated with increased E-selectin levels. Cardiovasc Diabetol.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Endoplasmic Reticulum Resident Protein 57 (ERp57) Antibody
abx444895 200 µg

Endoplasmic Reticulum Resident Protein 57 (ERp57) Antibody

Sign In for Pricing
View Details
Hcst (BC069220) Mouse Tagged Lenti ORF Clone
MR200079L4 10 µg

Hcst (BC069220) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
RhBG (B-9) Alexa Fluor® 680
sc-398816 AF680 200 µg/mL

RhBG (B-9) Alexa Fluor® 680

Sign In for Pricing
View Details
FSTL5 (NM_001128427) Human Tagged ORF Clone
RG226212 10 µg

FSTL5 (NM_001128427) Human Tagged ORF Clone

Sign In for Pricing
View Details
FCGR3A (Fc Fragment of IgG, Low Affinity IIIa, Receptor, CD16, FCG3, CD16A, FCGR3, IGFR3, FCR-10, FCRIII, FCGRIII, FCRIIIA) (Biotin)
MBS6417082-01 0.1 mL

FCGR3A (Fc Fragment of IgG, Low Affinity IIIa, Receptor, CD16, FCG3, CD16A, FCGR3, IGFR3, FCR-10, FCRIII, FCGRIII, FCRIIIA) (Biotin)

Sign In for Pricing
View Details
FCGR3A (Fc Fragment of IgG, Low Affinity IIIa, Receptor, CD16, FCG3, CD16A, FCGR3, IGFR3, FCR-10, FCRIII, FCGRIII, FCRIIIA) (Biotin)
MBS6417082-02 5x 0.1 mL

FCGR3A (Fc Fragment of IgG, Low Affinity IIIa, Receptor, CD16, FCG3, CD16A, FCGR3, IGFR3, FCR-10, FCRIII, FCGRIII, FCRIIIA) (Biotin)

Sign In for Pricing
View Details