Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Irisin, Human/Mouse/Rat (HEK293, N-His)

Irisin is a hormone derived from the FNDC5 gene that promotes energy expenditure via thermogenesis. Irisin Protein, Human/Mouse/Rat (HEK293, N-His) is the recombinant human, rat, mouse-derived Irisin protein, expressed by HEK293 , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Irisin Protein, Human/Mouse/Rat (HEK293, N-His), Human; Rat; Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/irisin-protein-human-mouse-rat-hek-293-his.html

Purity

98.0

Smiles

DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE

Molecular Formula

252995 (Gene_ID) Q8NAU1-1 (D32-E143) (Accession)

Molecular Weight

Approximately 18-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Hyeonwoo Kim, et al. Irisin Mediates Effects on Bone and Fat via αV Integrin Receptors. Cell.|[2]Karan S Rana, et al. Plasma irisin is elevated in type 2 diabetes and is associated with increased E-selectin levels. Cardiovasc Diabetol.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phf19 Mouse shRNA Plasmid (Locus ID 74016)
TL504883 1 Kit

Phf19 Mouse shRNA Plasmid (Locus ID 74016)

Sign In for Pricing
View Details
SNX3, ID (SNX3, Sorting nexin-3, Protein SDP3) (Azide free) (HRP)
MBS6349643-01 0.2 mL

SNX3, ID (SNX3, Sorting nexin-3, Protein SDP3) (Azide free) (HRP)

Sign In for Pricing
View Details
SNX3, ID (SNX3, Sorting nexin-3, Protein SDP3) (Azide free) (HRP)
MBS6349643-02 5x 0.2 mL

SNX3, ID (SNX3, Sorting nexin-3, Protein SDP3) (Azide free) (HRP)

Sign In for Pricing
View Details
Olfr1055 Lentiviral Activation Particles (m2)
sc-435101-LAC-2 200 µL

Olfr1055 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Anti-SEPT7 antibody
STJ71735 100 µg

Anti-SEPT7 antibody

Sign In for Pricing
View Details
MEK-3 (phospho Thr222) Rabbit Polyclonal Antibody
APRab05008-01 20 µL

MEK-3 (phospho Thr222) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details