Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Irisin, Human/Mouse/Rat (HEK293, N-His)

Irisin is a hormone derived from the FNDC5 gene that promotes energy expenditure via thermogenesis. Irisin Protein, Human/Mouse/Rat (HEK293, N-His) is the recombinant human, rat, mouse-derived Irisin protein, expressed by HEK293 , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Irisin Protein, Human/Mouse/Rat (HEK293, N-His), Human; Rat; Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/irisin-protein-human-mouse-rat-hek-293-his.html

Purity

98.0

Smiles

DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE

Molecular Formula

252995 (Gene_ID) Q8NAU1-1 (D32-E143) (Accession)

Molecular Weight

Approximately 18-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Hyeonwoo Kim, et al. Irisin Mediates Effects on Bone and Fat via αV Integrin Receptors. Cell.|[2]Karan S Rana, et al. Plasma irisin is elevated in type 2 diabetes and is associated with increased E-selectin levels. Cardiovasc Diabetol.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cryge 3'UTR GFP Stable Cell Line
TU154410 1.0 mL

Cryge 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Human Choline Acetyltransferase (CHAT) (NM_020986) AAV Particle
RC217232A1V 250 µL

Human Choline Acetyltransferase (CHAT) (NM_020986) AAV Particle

Sign In for Pricing
View Details
Nitrofurantoin 5g
A16008-5000 5000 mg

Nitrofurantoin 5g

Sign In for Pricing
View Details
Olr631 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV636509 1.0 µg DNA

Olr631 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
PSF2 (GINS2) (NM_016095) Human 3' UTR Clone
SC207425 10 µg

PSF2 (GINS2) (NM_016095) Human 3' UTR Clone

Sign In for Pricing
View Details
beta Arrestin 1 (ARRB1) CytoSection
TS401279P5 25 Slides

beta Arrestin 1 (ARRB1) CytoSection

Sign In for Pricing
View Details