Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Irisin, Human/Mouse/Rat (HEK293, N-His)

Irisin is a hormone derived from the FNDC5 gene that promotes energy expenditure via thermogenesis. Irisin Protein, Human/Mouse/Rat (HEK293, N-His) is the recombinant human, rat, mouse-derived Irisin protein, expressed by HEK293 , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Irisin Protein, Human/Mouse/Rat (HEK293, N-His), Human; Rat; Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/irisin-protein-human-mouse-rat-hek-293-his.html

Purity

98.0

Smiles

DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE

Molecular Formula

252995 (Gene_ID) Q8NAU1-1 (D32-E143) (Accession)

Molecular Weight

Approximately 18-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Hyeonwoo Kim, et al. Irisin Mediates Effects on Bone and Fat via αV Integrin Receptors. Cell.|[2]Karan S Rana, et al. Plasma irisin is elevated in type 2 diabetes and is associated with increased E-selectin levels. Cardiovasc Diabetol.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM92A1 (FAM92A) (NM_145269) Human Over-expression Lysate
LY407994 100 µg

FAM92A1 (FAM92A) (NM_145269) Human Over-expression Lysate

Sign In for Pricing
View Details
Interleukin 26 (IL26) BioAssayTM ELISA Kit (Human)
026204-01 48 Tests

Interleukin 26 (IL26) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
Interleukin 26 (IL26) BioAssayTM ELISA Kit (Human)
026204-02 96 Tests

Interleukin 26 (IL26) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
Rabbit Polyclonal Annexin A8/ANXA8 Antibody
NBP2-97051-100ul 100 µL

Rabbit Polyclonal Annexin A8/ANXA8 Antibody

Sign In for Pricing
View Details
Rabbit Anti CTSE Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(Western Blot, IHC, ELISA)
MBS8423576-01 0.12 mL

Rabbit Anti CTSE Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(Western Blot, IHC, ELISA)

Sign In for Pricing
View Details
Rabbit Anti CTSE Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(Western Blot, IHC, ELISA)
MBS8423576-02 0.2 mL

Rabbit Anti CTSE Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(Western Blot, IHC, ELISA)

Sign In for Pricing
View Details