Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Irisin, Human/Mouse/Rat (HEK293, N-His)

Irisin is a hormone derived from the FNDC5 gene that promotes energy expenditure via thermogenesis. Irisin Protein, Human/Mouse/Rat (HEK293, N-His) is the recombinant human, rat, mouse-derived Irisin protein, expressed by HEK293 , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Irisin Protein, Human/Mouse/Rat (HEK293, N-His), Human; Rat; Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/irisin-protein-human-mouse-rat-hek-293-his.html

Purity

98.0

Smiles

DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE

Molecular Formula

252995 (Gene_ID) Q8NAU1-1 (D32-E143) (Accession)

Molecular Weight

Approximately 18-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Hyeonwoo Kim, et al. Irisin Mediates Effects on Bone and Fat via αV Integrin Receptors. Cell.|[2]Karan S Rana, et al. Plasma irisin is elevated in type 2 diabetes and is associated with increased E-selectin levels. Cardiovasc Diabetol.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Serpinb9b shRNA (UAS) - Lentiviral mouse Serpinb9b shRNA (UAS) (100)
GTR15209130 1 Vial

Lentiviral mouse Serpinb9b shRNA (UAS) - Lentiviral mouse Serpinb9b shRNA (UAS) (100)

Sign In for Pricing
View Details
P120 Monoclonal Antibody
PA6752-01 1.5 mL

P120 Monoclonal Antibody

Sign In for Pricing
View Details
P120 Monoclonal Antibody
PA6752-02 3 mL

P120 Monoclonal Antibody

Sign In for Pricing
View Details
P120 Monoclonal Antibody
PA6752-03 6 mL

P120 Monoclonal Antibody

Sign In for Pricing
View Details
RNF125 Rabbit Polyclonal Antibody
TA315551 100 µL

RNF125 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MP qPCR Master Mix (2x), plus ROX Solution
E0425-03 1000 Reactions

MP qPCR Master Mix (2x), plus ROX Solution

Sign In for Pricing
View Details