Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INPP4B Peptide - middle region

INPP4B Peptide - middle region

Product Specifications

UniProt

O15327

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001095139.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HHSDYDEEEWDRVWANVGKSLNCIIAMVDKLIERDGGSEGSGGNNDGEKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NADE (BEX3) (NM_206915) Human Over-expression Lysate
LS027018 100 µg

NADE (BEX3) (NM_206915) Human Over-expression Lysate

Sign In for Pricing
View Details
AKT1 (v-akt Murine Thymoma Viral Oncogene Homolog 1, C-AKT, MGC99656, PKB, PRKBA, Protein kinase B, RAC, RAC-ALPHA, RAC-alpha serine/threonine-protein kinase, RAC-PK-alpha) (HRP)
A1125-05-HRP 100 µL

AKT1 (v-akt Murine Thymoma Viral Oncogene Homolog 1, C-AKT, MGC99656, PKB, PRKBA, Protein kinase B, RAC, RAC-ALPHA, RAC-alpha serine/threonine-protein kinase, RAC-PK-alpha) (HRP)

Sign In for Pricing
View Details
U2AF2 siRNA (Human)
orb1860493-01 15 nmol

U2AF2 siRNA (Human)

Sign In for Pricing
View Details
U2AF2 siRNA (Human)
orb1860493-02 30 nmol

U2AF2 siRNA (Human)

Sign In for Pricing
View Details
Hsa-miR-193b-3p miRNA Mimic
CMH0250-01 5 nmol

Hsa-miR-193b-3p miRNA Mimic

Sign In for Pricing
View Details
Hsa-miR-193b-3p miRNA Mimic
CMH0250-02 10 nmol

Hsa-miR-193b-3p miRNA Mimic

Sign In for Pricing
View Details