Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INPP4B Peptide - middle region

INPP4B Peptide - middle region

Product Specifications

UniProt

O15327

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001095139.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HHSDYDEEEWDRVWANVGKSLNCIIAMVDKLIERDGGSEGSGGNNDGEKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aurora-B (ARK/STK12) Antibody Blocking peptide
orb1446849 500 µg

Aurora-B (ARK/STK12) Antibody Blocking peptide

Sign In for Pricing
View Details
Screw cap only with EPR gasket, yellow, 500/pack
1480-0506 500/PCK

Screw cap only with EPR gasket, yellow, 500/pack

Sign In for Pricing
View Details
Anti-RING2 Polyclonal Antibody
TMAB-12262-01 50 μL

Anti-RING2 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-RING2 Polyclonal Antibody
TMAB-12262-02 100 µL

Anti-RING2 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-RING2 Polyclonal Antibody
TMAB-12262-03 200 µL

Anti-RING2 Polyclonal Antibody

Sign In for Pricing
View Details
GFAP (Glial Fibrillary Acidic Protein) (MaxLight 750) discontinued
214855-ML750 100 µL

GFAP (Glial Fibrillary Acidic Protein) (MaxLight 750) discontinued

Sign In for Pricing
View Details