FGF17 Peptide - middle region
FGF17 Peptide - middle region
Product Specifications
Product Name Alternative
HH20, FGF-13, FGF-17
UniProt
O60258
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
NCBI Accession Number
NP_001291407.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
NBP3-28018MFV500 0.1 mL
Human Monoclonal Siglec-15 Antibody (Medimmune patent anti-Siglec-15) [mFluor Violet 500 SE]
Sign In for Pricing
View Details DZ41516-PE 200 µL/Vial
Anti-Fruit fly Centaurin b1a Antibody, PE Conjugate
Sign In for Pricing
View Details S5328-95H 50 µg
Solute Carrier Family 5 (Sodium/Glucose Cotransporter), Member 9 (SLC5A9, MGC132517, MGC132523, SGLT4) discontinued
Sign In for Pricing
View Details