Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF17 Peptide - middle region

FGF17 Peptide - middle region

Product Specifications

Product Name Alternative

HH20, FGF-13, FGF-17

UniProt

O60258

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001291407.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NF-kappaB p100/p52 Antibody (Phospho-Ser865)
OAAF07752-100UG 100 µg

NF-kappaB p100/p52 Antibody (Phospho-Ser865)

Sign In for Pricing
View Details
Indobufen Impurity 67
RM-I041593-01 10 mg

Indobufen Impurity 67

Sign In for Pricing
View Details
Indobufen Impurity 67
RM-I041593-02 25 mg

Indobufen Impurity 67

Sign In for Pricing
View Details
Indobufen Impurity 67
RM-I041593-03 50 mg

Indobufen Impurity 67

Sign In for Pricing
View Details
Indobufen Impurity 67
RM-I041593-04 100 mg

Indobufen Impurity 67

Sign In for Pricing
View Details
Dram2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
18591116 3x 1.0 µg

Dram2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details