Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDC123 Peptide - N-terminal region

CDC123 Peptide - N-terminal region

Product Specifications

Product Name Alternative

D123, C10orf7

UniProt

O75794

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_006014.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VILPLPQNVKDYLLDDGTLVVSGRDDPPTHSQPDSDDEAEEIQWSDDENT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thg1l (BC092541) Mouse Tagged ORF Clone
MR204142 10 µg

Thg1l (BC092541) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
SLC29A1 Polyclonal Antibody
E-AB-66025-01 60 µL

SLC29A1 Polyclonal Antibody

Sign In for Pricing
View Details
SLC29A1 Polyclonal Antibody
E-AB-66025-02 120 µL

SLC29A1 Polyclonal Antibody

Sign In for Pricing
View Details
SLC29A1 Polyclonal Antibody
E-AB-66025-03 200 µL

SLC29A1 Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Carboxypeptidase A3, Mast Cell (CPA3) ELISA Kit
RDR-CPA3-Mu-48Tests 48 Tests

Mouse Carboxypeptidase A3, Mast Cell (CPA3) ELISA Kit

Sign In for Pricing
View Details
Triticum vulgare (WGA, Wheat Germ, Agglutinin)
MBS656844-01 10 mg

Triticum vulgare (WGA, Wheat Germ, Agglutinin)

Sign In for Pricing
View Details