Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAT8 Peptide - N-terminal region

NAT8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GLA, CML1, CCNAT, Hcml1, ATase2, TSC501, TSC510

UniProt

Q9UHE5

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_003951.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KYQESDRQWVVGLLSRGMAEHAPATFRQLLKLPRTLILLLGGPLALLLVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-SHB (Tyr246) Rabbit Polyclonal Antibody (Cy7)
orb1076742 100 µL

Phospho-SHB (Tyr246) Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
Cystatin A (CSTA) Antibody Pair
abx370395-01 5x 96 Tests

Cystatin A (CSTA) Antibody Pair

Sign In for Pricing
View Details
Cystatin A (CSTA) Antibody Pair
abx370395-02 10x 96 Tests

Cystatin A (CSTA) Antibody Pair

Sign In for Pricing
View Details
Canine acrolein (ACR) ELISA Kit
MBS7242740-01 48 Well

Canine acrolein (ACR) ELISA Kit

Sign In for Pricing
View Details
Canine acrolein (ACR) ELISA Kit
MBS7242740-02 96 Well

Canine acrolein (ACR) ELISA Kit

Sign In for Pricing
View Details
Canine acrolein (ACR) ELISA Kit
MBS7242740-03 5x 96 Well

Canine acrolein (ACR) ELISA Kit

Sign In for Pricing
View Details