NAT8 Peptide - N-terminal region
NAT8 Peptide - N-terminal region
Product Specifications
Product Name Alternative
GLA, CML1, CCNAT, Hcml1, ATase2, TSC501, TSC510
UniProt
Q9UHE5
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
NCBI Accession Number
NP_003951.3
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KYQESDRQWVVGLLSRGMAEHAPATFRQLLKLPRTLILLLGGPLALLLVS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR10405367 96 Well
Porcine C type lectin domain family 2 member D (CLEC2D) ELISA kit
Sign In for Pricing
View Details 
301358-ML405 100 µL
Frizzled (Frizzled-9, Fzd3, Frizzled (Drosophila) homolog 3, FzE6, hFz9, fzd9, Fz9, FZD3, Frizzled 9) (MaxLight 405) discontinued
Sign In for Pricing
View Details A00144-iFluor647 100 µg
Anti-CD11b/ITGAM Antibody Picoband® (iFluor647 Conjugate)
Sign In for Pricing
View Details 
MR211091L4V 200 µL
Pcdh10 (NM_011043) Mouse Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details M04796-2-Fluoro594 100 µg/Vial
Anti-Annexin A3 Antibody Picoband® (monoclonal, 2H3H8) Fluoro594 Conjugated
Sign In for Pricing
View Details