Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC7A6 Peptide - N-terminal region

SLC7A6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

LAT3, LAT-2, y+LAT-2

UniProt

Q92536

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001070253.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSPPQRSSETMQLKKEISLLNGVSLVVGNMIGSGIFVSPKGVLVHTASYG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRT83 Rabbit pAb, PerCP-Cy7 conjugated
orb2858996 100 µL

KRT83 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
(1S,2S) - (+) -N-Boc-2-amino-1-phenyl-1,3-propanediol
sc-287405 1 g

(1S,2S) - (+) -N-Boc-2-amino-1-phenyl-1,3-propanediol

Sign In for Pricing
View Details
Lentiviral human MTURN sgRNA gene knockout kit - Lentiviral human MTURN sgRNA gene knockout kit (plasmid)
GTR15385727 1 Vial

Lentiviral human MTURN sgRNA gene knockout kit - Lentiviral human MTURN sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
CLK3 Conjugated Antibody
MBS9452835-01 0.1 mL (AF350)

CLK3 Conjugated Antibody

Sign In for Pricing
View Details
CLK3 Conjugated Antibody
MBS9452835-02 0.1 mL (AF405)

CLK3 Conjugated Antibody

Sign In for Pricing
View Details
CLK3 Conjugated Antibody
MBS9452835-03 0.1 mL (AF488)

CLK3 Conjugated Antibody

Sign In for Pricing
View Details