Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP14 Peptide - middle region

USP14 Peptide - middle region

Product Specifications

Product Name Alternative

TGT

UniProt

P54578

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001032411.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EKMVSFRSKFKDLEDKKVNQQPNTSDKKSSPQKEVKYEPFSFADDIGSNN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTR1A Protein Vector (Mouse) (pPM-C-HA)
PV152104 500 ng

ACTR1A Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse Lrp1 Pre-designed siRNA Set A
SI107809A 1 Each

Mouse Lrp1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
THAP4 Antibody
orb521732-01 50 μL

THAP4 Antibody

Sign In for Pricing
View Details
THAP4 Antibody
orb521732-02 100 µL

THAP4 Antibody

Sign In for Pricing
View Details
MroI (5 x 40 U)
CAC-TYB-MRO-101X5 1 Set

MroI (5 x 40 U)

Sign In for Pricing
View Details
YAP1 (phospho-S127) polyclonal antibody
BS67083-01 50 µL

YAP1 (phospho-S127) polyclonal antibody

Sign In for Pricing
View Details