Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP14 Peptide - middle region

USP14 Peptide - middle region

Product Specifications

Product Name Alternative

TGT

UniProt

P54578

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001032411.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EKMVSFRSKFKDLEDKKVNQQPNTSDKKSSPQKEVKYEPFSFADDIGSNN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Binocular Biological Microscope
LX1217BMC 1 Unit

Binocular Biological Microscope

Sign In for Pricing
View Details
DL-Tartaric acid (Standard)
HY-Y1315R-01 25 mg

DL-Tartaric acid (Standard)

Sign In for Pricing
View Details
DL-Tartaric acid (Standard)
HY-Y1315R-02 50 mg

DL-Tartaric acid (Standard)

Sign In for Pricing
View Details
DL-Tartaric acid (Standard)
HY-Y1315R-03 100 mg

DL-Tartaric acid (Standard)

Sign In for Pricing
View Details
DL-Tartaric acid (Standard)
HY-Y1315R-04 250 mg

DL-Tartaric acid (Standard)

Sign In for Pricing
View Details
Bromodeoxyuridine (BrdU) (Biotin)
MBS6466017-01 0.25 mg

Bromodeoxyuridine (BrdU) (Biotin)

Sign In for Pricing
View Details