Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B4GALT5 Peptide - middle region

B4GALT5 Peptide - middle region

Product Specifications

Product Name Alternative

Gt-V, B4Gal-T5, beta4Gal-T5, beta4GalT-V, BETA4-GALT-IV

UniProt

O43286

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_004767.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LRSAYAKRNSSVNDSDYPLDLNHSETFLQTTTFLPEDFTYFANHTCPERL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl 4-Acetylbenzoate
TRC-E897250-25G 25 g

Ethyl 4-Acetylbenzoate

Sign In for Pricing
View Details
Mini Centrifuge BCMI-504
BCMI-504 1 Unit

Mini Centrifuge BCMI-504

Sign In for Pricing
View Details
Tissue Protein Lysate, Colon
CP565773 150 µg

Tissue Protein Lysate, Colon

Sign In for Pricing
View Details
CD23 (Fc Epsilon RII) (FCER2/3592), CF405S conjugate, 0.1mg/mL
BNC043592-500 1x 500 µL

CD23 (Fc Epsilon RII) (FCER2/3592), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
H-Ala-2-CT Polystyrene Resin
H0370753301.5G 5 g

H-Ala-2-CT Polystyrene Resin

Sign In for Pricing
View Details
IBP160 (AQR) Rabbit Polyclonal Antibody
TA373624 100 µL

IBP160 (AQR) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details