CNOT8 Peptide - middle region
CNOT8 Peptide - middle region
Product Specifications
Product Name Alternative
CAF1, POP2, CALIF, Caf1b, hCAF1
UniProt
Q9UFF9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
NCBI Accession Number
NP_001288002.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DYQYQLLRCNVDLLKIIQLGLTFTNEKGEYPSGINTWQFNFKFNLTEDMY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6317656-01 0.1 mL
LY86, CT (LY86, MD1, Lymphocyte antigen 86, Protein MD-1) (MaxLight 650)
Sign In for Pricing
View Details MBS6317656-02 5x 0.1 mL
LY86, CT (LY86, MD1, Lymphocyte antigen 86, Protein MD-1) (MaxLight 650)
Sign In for Pricing
View Details 
GTR10350172 96 Well
Bovine Spermatid associated protein (SPERT) ELISA Kit
Sign In for Pricing
View Details TL503038V 500 µL Each
Apbb1ip Mouse shRNA Lentiviral Particle (Locus ID 54519)
Sign In for Pricing
View Details