Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNOT8 Peptide - middle region

CNOT8 Peptide - middle region

Product Specifications

Product Name Alternative

CAF1, POP2, CALIF, Caf1b, hCAF1

UniProt

Q9UFF9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001288002.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DYQYQLLRCNVDLLKIIQLGLTFTNEKGEYPSGINTWQFNFKFNLTEDMY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYP27B1 AAV Vector (Human) (CMV)
17331101 1 µg

CYP27B1 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Phospho-NFKB1 (Thr931) Rabbit Polyclonal Antibody (APC-Cy5.5)
orb1588390 100 µL

Phospho-NFKB1 (Thr931) Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
3-Hydroxyquinoline
sc-482637 1 g

3-Hydroxyquinoline

Sign In for Pricing
View Details
ZNF702 (NM_024924) Human Tagged Lenti ORF Clone
RC207462L3 10 µg

ZNF702 (NM_024924) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
SIRT2 Inhibitor, Mammalian, BioAssayTM Screening Kit discontinued
167964 100 Tests

SIRT2 Inhibitor, Mammalian, BioAssayTM Screening Kit discontinued

Sign In for Pricing
View Details
RNU7-8P sgRNA CRISPR Lentivector (Human) (Target 2)
K1855303 1.0 µg DNA

RNU7-8P sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details