Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NRXN3 Peptide - C-terminal region

NRXN3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C14orf60

UniProt

Q9Y4C0

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_004787.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YKYRNRDEGSYQVDETRNYISNSAQSNGTLMKEKQQSSKSGHKKQKNKDR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pbdc1 (NM_001108818) Rat Tagged Lenti ORF Clone
RR203055L3 10 µg

Pbdc1 (NM_001108818) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Cyp2c44 Protein Vector (Mouse) (pPM-C-HA)
17374025 500 ng

Cyp2c44 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
VERO C1008 (E6) -Cas9 Cell Line
RG-002 1x 10^6

VERO C1008 (E6) -Cas9 Cell Line

Sign In for Pricing
View Details
HNRNPA1 Protein Vector (Human) (pPB-C-His)
PV084073 500 ng

HNRNPA1 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
IL-3 (G-11) HRP
sc-398210 HRP 200 µg/mL

IL-3 (G-11) HRP

Sign In for Pricing
View Details
FRMD2 Polyclonal Antibody, PerCP Conjugated
bs-8233R-PerCP 100 µL

FRMD2 Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details