Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PEX16 Peptide - middle region

PEX16 Peptide - middle region

Product Specifications

Product Name Alternative

PBD8A, PBD8B

UniProt

Q9Y5Y5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_004804.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QPPDGDHSPGNHEQSYVGKRSNRVVRTLQNTPSLHSRHWGAPQQREGRQQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Tissue Factor Pathway Inhibitor 2 ELISA Kit
MBS023444-01 48 Well

Sheep Tissue Factor Pathway Inhibitor 2 ELISA Kit

Sign In for Pricing
View Details
Sheep Tissue Factor Pathway Inhibitor 2 ELISA Kit
MBS023444-02 96 Well

Sheep Tissue Factor Pathway Inhibitor 2 ELISA Kit

Sign In for Pricing
View Details
Sheep Tissue Factor Pathway Inhibitor 2 ELISA Kit
MBS023444-03 5x 96 Well

Sheep Tissue Factor Pathway Inhibitor 2 ELISA Kit

Sign In for Pricing
View Details
Sheep Tissue Factor Pathway Inhibitor 2 ELISA Kit
MBS023444-04 10x 96 Well

Sheep Tissue Factor Pathway Inhibitor 2 ELISA Kit

Sign In for Pricing
View Details
KCNG3 Polyclonal Antibody
E-AB-16537-01 20 µL

KCNG3 Polyclonal Antibody

Sign In for Pricing
View Details
KCNG3 Polyclonal Antibody
E-AB-16537-02 60 µL

KCNG3 Polyclonal Antibody

Sign In for Pricing
View Details