Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PEX16 Peptide - middle region

PEX16 Peptide - middle region

Product Specifications

Product Name Alternative

PBD8A, PBD8B

UniProt

Q9Y5Y5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_004804.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QPPDGDHSPGNHEQSYVGKRSNRVVRTLQNTPSLHSRHWGAPQQREGRQQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Rab3c shRNA (UAS) - Lentiviral mouse Rab3c shRNA (UAS) (100)
GTR15244422 1 Vial

Lentiviral mouse Rab3c shRNA (UAS) - Lentiviral mouse Rab3c shRNA (UAS) (100)

Sign In for Pricing
View Details
PDE1B Antibody, HRP conjugated
CSB-PA27759B0Rb-01 50 μL

PDE1B Antibody, HRP conjugated

Sign In for Pricing
View Details
PDE1B Antibody, HRP conjugated
CSB-PA27759B0Rb-02 100 µL

PDE1B Antibody, HRP conjugated

Sign In for Pricing
View Details
ANXA2 Knockout HAP1 Polyclonal Cells
ARG21830 1 Million

ANXA2 Knockout HAP1 Polyclonal Cells

Sign In for Pricing
View Details
BC024651 Recombinant Protein (Human)
RP002788 100 µg

BC024651 Recombinant Protein (Human)

Sign In for Pricing
View Details
Hsa-miR-630 miRNA Inhibitor
orb1873102-01 10 nmol

Hsa-miR-630 miRNA Inhibitor

Sign In for Pricing
View Details