What is the catalog number for LY86 Peptide - N-terminal region?

The catalog number for LY86 Peptide - N-terminal region is orb2001489.

What sizes are available for LY86 Peptide - N-terminal region?

LY86 Peptide - N-terminal region is available in the following size(s): 100 µg.

Is LY86 Peptide - N-terminal region in stock?

LY86 Peptide - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

LY86 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MD1, MD-1, MMD-1, dJ80N2.1

UniProt

O95711

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_004262.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PICEAALPKFSFCGRRKGEQIYYAGPVNNPEFTIPQGEYQVLLELYTEKR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

sc-339072A 5 g

1-nitro-4-[ (4-nitrophenyl) thio]benzene

Sign In for Pricing

View Details

E44H01953 100 µL

CRP1 Polyclonal Antibody

Sign In for Pricing

View Details

orb2812188-01 48 Tests

Mouse S100 Calcium Binding Protein A4 (S100A4) ELISA Kit

Sign In for Pricing

View Details

orb2812188-02 96 Tests

Mouse S100 Calcium Binding Protein A4 (S100A4) ELISA Kit

Sign In for Pricing

View Details

orb2812188-03 5 x 96 T

Mouse S100 Calcium Binding Protein A4 (S100A4) ELISA Kit

Sign In for Pricing

View Details

HY-RS25676 1 Set

Echs1 Rat Pre-designed siRNA Set A

Sign In for Pricing

View Details